Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FKBP1A (Human) Recombinant Protein (P01)

  • Catalog # : H00002280-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FKBP1A full-length ORF ( AAH05147, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.62
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002280-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2280
  • Gene Name:
  • FKBP1A
  • Gene Alias:
  • FKBP-12,FKBP1,FKBP12,FKBP12C,PKC12,PKCI2,PPIASE
  • Gene Description:
  • FK506 binding protein 1A, 12kDa
  • Gene Summary:
  • The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. [provided by RefSeq
  • Other Designations:
  • FK506-binding protein 1,FK506-binding protein 12,FK506-binding protein 1A (12kD),FK506-binding protein, T-cell, 12-kD,OTTHUMP00000029978,immunophilin FKBP12,peptidyl-prolyl cis-trans isomerase,protein kinase C inhibitor 2,rotamase
  • RSS
  • YouTube
  • Linkedin
  • Facebook