FKBP1A (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FKBP1A full-length ORF ( AAH05147, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.62
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FKBP1A
Entrez GeneID
2280GeneBank Accession#
BC005147Protein Accession#
AAH05147Gene Name
FKBP1A
Gene Alias
FKBP-12, FKBP1, FKBP12, FKBP12C, PKC12, PKCI2, PPIASE
Gene Description
FK506 binding protein 1A, 12kDa
Omim ID
186945Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. [provided by RefSeq
Other Designations
FK506-binding protein 1|FK506-binding protein 12|FK506-binding protein 1A (12kD)|FK506-binding protein, T-cell, 12-kD|OTTHUMP00000029978|immunophilin FKBP12|peptidyl-prolyl cis-trans isomerase|protein kinase C inhibitor 2|rotamase
-
Interactome
-
Disease
-
Publication Reference
-
Impact of hypoxia, simulated ischemia and reperfusion in HL-1 cells on the expression of FKBP12/FKBP12.6 and intracellular calcium dynamics.
Åström-Olsson K, Li L, Olofsson CS, Borén J, Öhlin H, Grip L.
Biochemical and Biophysical Research Communications 2012 Jun; 422(4):732.
Application:WB-Re, Recombinant protein.
-
Coupling surface plasmon resonance to mass spectrometry to discover novel protein?Vprotein interactions.
Madeira A, Ohman E, Nilsson A, Sjogren B, Andren PE, Svenningsson P.
Nature Protocols 2009 Jun; 4(7):1023.
Application:Func, Mouse, Rat, Brain.
-
Increased Striatal mRNA and Protein Levels of the Immunophilin FKBP-12 in Experimental Parkinson's Disease and Identification of FKBP-12-Binding Proteins.
Nilsson A, Skold K, Sjogren B, Svensson M, Pierson J, Zhang X, Caprioli RM, Buijs J, Persson B, Svenningsson P, Andren PE.
Journal of Proteome Research 2007 Sep; 6(10):3952.
Application:WB, Recombinant protein.
-
Impact of hypoxia, simulated ischemia and reperfusion in HL-1 cells on the expression of FKBP12/FKBP12.6 and intracellular calcium dynamics.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com