FKBP1A monoclonal antibody (M01), clone 1E5-A12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FKBP1A monoclonal antibody (M01), clone 1E5-A12 Western Blot analysis of FKBP1A expression in HL-60 ( Cat # L014V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of FKBP1A expression in transfected 293T cell line by FKBP1A monoclonal antibody (M01), clone 1E5-A12.
Lane 1: FKBP1A transfected lysate(12 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FKBP1A is 3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.62 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant FKBP1A.
Immunogen
FKBP1A (AAH05147, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FKBP1A monoclonal antibody (M01), clone 1E5-A12 Western Blot analysis of FKBP1A expression in HL-60 ( Cat # L014V1 ).Western Blot (Transfected lysate)
Western Blot analysis of FKBP1A expression in transfected 293T cell line by FKBP1A monoclonal antibody (M01), clone 1E5-A12.
Lane 1: FKBP1A transfected lysate(12 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FKBP1A is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — FKBP1A
Entrez GeneID
2280GeneBank Accession#
BC005147Protein Accession#
AAH05147Gene Name
FKBP1A
Gene Alias
FKBP-12, FKBP1, FKBP12, FKBP12C, PKC12, PKCI2, PPIASE
Gene Description
FK506 binding protein 1A, 12kDa
Omim ID
186945Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. [provided by RefSeq
Other Designations
FK506-binding protein 1|FK506-binding protein 12|FK506-binding protein 1A (12kD)|FK506-binding protein, T-cell, 12-kD|OTTHUMP00000029978|immunophilin FKBP12|peptidyl-prolyl cis-trans isomerase|protein kinase C inhibitor 2|rotamase
-
Interactome
-
Disease
-
Publication Reference
-
Protein-protein interactions: an application of tus-ter mediated protein microarray system.
Sitaraman K, Chatterjee DK.
Methods Mol Biol 2011 Mar; 723:185.
Application：Func, Recombinant protein.
-
Protein-protein interactions: an application of tus-ter mediated protein microarray system.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com