FHL2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
FHL2 MaxPab rabbit polyclonal antibody. Western Blot analysis of FHL2 expression in human pancreas.
Western Blot (Tissue lysate)
FHL2 MaxPab rabbit polyclonal antibody. Western Blot analysis of FHL2 expression in mouse brain.
Western Blot (Cell lysate)
FHL2 MaxPab rabbit polyclonal antibody. Western Blot analysis of FHL2 expression in NIH/3T3.
Western Blot (Transfected lysate)
Western Blot analysis of FHL2 expression in transfected 293T cell line (H00002274-T01) by FHL2 MaxPab polyclonal antibody.
Lane 1: FHL2 transfected lysate(32.20 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human FHL2 protein.
Immunogen
FHL2 (NP_963849.1, 1 a.a. ~ 279 a.a) full-length human protein.
Sequence
MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FHL2 MaxPab rabbit polyclonal antibody. Western Blot analysis of FHL2 expression in human pancreas.Western Blot (Tissue lysate)
FHL2 MaxPab rabbit polyclonal antibody. Western Blot analysis of FHL2 expression in mouse brain.Western Blot (Cell lysate)
FHL2 MaxPab rabbit polyclonal antibody. Western Blot analysis of FHL2 expression in NIH/3T3.Western Blot (Transfected lysate)
Western Blot analysis of FHL2 expression in transfected 293T cell line (H00002274-T01) by FHL2 MaxPab polyclonal antibody.
Lane 1: FHL2 transfected lysate(32.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FHL2
Entrez GeneID
2274GeneBank Accession#
NM_201555.1Protein Accession#
NP_963849.1Gene Name
FHL2
Gene Alias
AAG11, DRAL, SLIM3
Gene Description
four and a half LIM domains 2
Omim ID
602633Gene Ontology
HyperlinkGene Summary
LIM proteins contain a highly conserved double zinc finger motif called the LIM domain.[supplied by OMIM
Other Designations
aging-associated gene 11|down-regulated in rhabdomyosarcoma LIM protein|four and a half LIM-domain protein 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com