FGL1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human FGL1 protein.
Immunogen
FGL1 (NP_004458.3, 1 a.a. ~ 312 a.a) full-length human protein.
Sequence
MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (82)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FGL1 MaxPab rabbit polyclonal antibody. Western Blot analysis of FGL1 expression in mouse intestine.Western Blot (Transfected lysate)
Western Blot analysis of FGL1 expression in transfected 293T cell line (H00002267-T01) by FGL1 MaxPab polyclonal antibody.
Lane 1: FGL1 transfected lysate(36.40 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FGL1
Entrez GeneID
2267GeneBank Accession#
NM_004467.3Protein Accession#
NP_004458.3Gene Name
FGL1
Gene Alias
HFREP1, HP-041, LFIRE1, MGC12455
Gene Description
fibrinogen-like 1
Omim ID
605776Gene Ontology
HyperlinkGene Summary
Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins. However, this protein lacks the platelet-binding site, cross-linking region and a thrombin-sensitive site which are necessary for fibrin clot formation. This protein may play a role in the development of hepatocellular carcinomas. Four alternatively spliced transcript variants encoding the same protein exist for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000122468|hepassocin|hepatocellular carcinoma-related sequence|hepatocyte-derived fibrinogen-related protein 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com