FGFR2 monoclonal antibody (M01), clone 1G3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FGFR2.
Immunogen
FGFR2 (AAH39243, 621 a.a. ~ 723 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (97)
Specificity
This antibody cross-reacts with human FGFR1 and human FGFR3.
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FGFR2 expression in transfected 293T cell line by FGFR2 monoclonal antibody (M01), clone 1G3.
Lane 1: FGFR2 transfected lysate (Predicted MW: 92 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FGFR2 on formalin-fixed paraffin-embedded human stomach carcinoma tissue. [antibody concentration 5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FGFR2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — FGFR2
Entrez GeneID
2263GeneBank Accession#
BC039243Protein Accession#
AAH39243Gene Name
FGFR2
Gene Alias
BEK, BFR-1, CD332, CEK3, CFD1, ECT1, FLJ98662, JWS, K-SAM, KGFR, TK14, TK25
Gene Description
fibroblast growth factor receptor 2
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member is a high-affinity receptor for acidic, basic and/or keratinocyte growth factor, depending on the isoform. Mutations in this gene are associated with Crouzon syndrome, Pfeiffer syndrome, Craniosynostosis, Apert syndrome, Jackson-Weiss syndrome, Beare-Stevenson cutis gyrata syndrome, Saethre-Chotzen syndrome, and syndromic craniosynostosis. Multiple alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq
Other Designations
BEK fibroblast growth factor receptor|FGF receptor|OTTHUMP00000020621|OTTHUMP00000020629|bacteria-expressed kinase|hydroxyaryl-protein kinase|keratinocyte growth factor receptor|protein tyrosine kinase, receptor like 14|soluble FGFR4 variant 4
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
FGF7/FGFR2-JunB signalling counteracts the effect of progesterone in luminal breast cancer.
Kamil Mieczkowski, Kamila Kitowska, Marcin Braun, Barbara Galikowska-Bogut, Monika Gorska-Arcisz, Dominika Piasecka, Konrad Stawiski, Anna J Zaczek, Dariusz Nejc, Radzisław Kordek, Hanna M Romanska, Rafal Sadej.
Molecular Oncology 2022 Aug; 16(15):2823.
Application:IHC, Human, Breast cancer tissue.
-
A 'Real-Life' Experience on Automated Digital Image Analysis of FGFR2 Immunohistochemistry in Breast Cancer.
Marcin Braun, Dominika Piasecka, Mateusz Bobrowski, Radzislaw Kordek, Rafal Sadej, Hanna M Romanska.
Diagnostics (Basel, Switzerland) 2020 Dec; 10(12):1060.
Application:IHC-P, Human, Human invasive ductal breast carcinomas.
-
FGFR2-Driven Signaling Counteracts Tamoxifen Effect on ERα-Positive Breast Cancer Cells.
Turczyk L, Kitowska K, Mieszkowska M, Mieczkowski K, Czaplinska D, Piasecka D, Kordek R, Skladanowski AC, Potemski P, Romanska HM, Sadej R.
Neoplasia 2017 Oct; 19(10):791.
Application:IHC-P, Human, Human breast cancer tissues.
-
Interactions between FGFR2 and RSK2-implications for breast cancer prognosis.
Czaplinska D, Mieczkowski K, Supernat A, Skladanowski AC, Kordek R, Biernat W, Zaczek AJ, Romanska HM, Sadej R.
Tumour Biology 2016 Oct; 37(10):13721.
Application:IHC-P, Human, Breast cancer.
-
Conserved roles of fibroblast growth factor receptor 2 signaling in the regulation of inner cell mass development in bovine blastocysts.
Akizawa H, Nagatomo H, Odagiri H, Kohri N, Yamauchi N, Yanagawa Y, Nagano M, Takahashi M, Kawahara M.
Molecular Reproduction and Development 2016 Jun; 83(6):516.
Application:IF, Bovine, Blastocyst.
-
Clinical significance of fibroblast growth factor receptor 2 expression in patients with residual rectal cancer after preoperative chemoradiotherapy: relationship with KRAS or BRAF mutations and MSI status.
Yoon G, Lee H, Kim JH, Hur K, Seo AN.
Amino Acids 2016 Jan; 37(8):10209.
Application:IHC-P, Human, Human rectal cancer.
-
Epithelial-mesenchymal transition confers resistance to selective FGFR inhibitors in SNU-16 gastric cancer cells.
Grygielewicz P, Dymek B, Bujak A, Gunerka P, Stanczak A, Lamparska-Przybysz M, Wieczorek M, Dzwonek K, Zdzalik D.
Gastric Cancer 2016 Jan; 19(1):53.
Application:WB-Ce, Human, SNU-16, SNU-16R cells.
-
Mannose phosphate isomerase regulates fibroblast growth factor receptor family signaling and glioma radiosensitivity.
Cazet A, Charest J, Bennett DC, Sambrooks CL, Contessa JN.
PLoS One 2014 Oct; 9(10):e110345.
Application:IF, IP-WB, WB, Human, U-251, KatoIII cells.
-
Low Prognostic Implication of Fibroblast Growth Factor Family Activation in Triple-negative Breast Cancer Subsets.
Lee HJ, Seo AN, Park SY, Kim JY, Park JY, Yu JH, Ahn JH, Gong G.
Annals of Surgical Oncology 2014 May; 21(5):1561.
Application:IHC-P, Human, Triple-negative breast cancer.
-
Upregulation of ANGPTL4 Messenger RNA and Protein in Severely Calcified Carotid Plaques.
Katano H, Yamada K.
Journal of Stroke and Cerebrovascular Diseases 2014 May; 23(5):933.
Application:WB, IHC, Human, Human carotid artery.
-
The expression of fibroblast growth factor receptors during early bovine conceptus development and pharmacological analysis of their actions on trophoblast growth in vitro.
Ozawa M, Yang QE, Ealy AD.
Reproduction 2013 Jan; 145(2):191.
Application:IF, Bovine, Bovine blastocysts.
-
Differential expression of growth factor receptors and membrane-bound tumor markers for imaging in male and female breast cancer.
Vermeulen JF, Kornegoor R, van der Wall E, van der Groep P, van Diest PJ.
PLoS One 2013 Jan; 8(1):e53353.
Application:IHC-P, Human, Breast cancer.
-
FGF7/FGFR2-JunB signalling counteracts the effect of progesterone in luminal breast cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com