FGF12 monoclonal antibody (M10), clone 1D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a full length recombinant FGF12.
Immunogen
FGF12 (AAH22524, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (45.65 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FGF12 expression in transfected 293T cell line by FGF12 monoclonal antibody (M10), clone 1D9.
Lane 1: FGF12 transfected lysate(27.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FGF12 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FGF12 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — FGF12
Entrez GeneID
2257GeneBank Accession#
BC022524Protein Accession#
AAH22524Gene Name
FGF12
Gene Alias
FGF12B, FHF1
Gene Description
fibroblast growth factor 12
Omim ID
601513Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
fibroblast growth factor 12B|fibroblast growth factor FGF-12b|fibroblast growth factor homologous factor 1|myocyte-activating factor
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Identification and Validation of Fibroblast Growth Factor 12 Gene as a Novel Potential Biomarker in Esophageal Cancer Using Cancer Genomic Datasets.
Bhushan A, Singh A, Kapur S, Borthakar BB, Sharma J, Rai AK, Kataki AC, Saxena S.
Omics : a Journal of Integrative Biology 2017 Oct; 21(10):616.
Application:WB-Tr, Human, KYSE410 cells.
-
Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
Chattopadhyay I, Singh A, Phukan R, Purkayastha J, Kataki A, Mahanta J, Saxena S, Kapur S.
Mutation Research 2010 Feb; 696(2):130.
Application:IHC-P, Human, Tissue microarray.
-
Identification and Validation of Fibroblast Growth Factor 12 Gene as a Novel Potential Biomarker in Esophageal Cancer Using Cancer Genomic Datasets.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com