FGF8 monoclonal antibody (M01), clone 2A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FGF8.
Immunogen
FGF8 (NP_149354, 65 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGK
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FGF8 monoclonal antibody (M01), clone 2A10. Western Blot analysis of FGF8 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
FGF8 monoclonal antibody (M01), clone 2A10. Western Blot analysis of FGF8 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
FGF8 monoclonal antibody (M01), clone 2A10 Western Blot analysis of FGF8 expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
FGF8 monoclonal antibody (M01), clone 2A10. Western Blot analysis of FGF8 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
FGF8 monoclonal antibody (M01), clone 2A10. Western Blot analysis of FGF8 expression in NIH/3T3(Cat # L018V1 ).Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FGF8 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — FGF8
Entrez GeneID
2253GeneBank Accession#
NM_033164Protein Accession#
NP_149354Gene Name
FGF8
Gene Alias
AIGF, HBGF-8, MGC149376
Gene Description
fibroblast growth factor 8 (androgen-induced)
Omim ID
600483Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants. [provided by RefSeq
Other Designations
OTTHUMP00000020348|OTTHUMP00000020349|OTTHUMP00000020350|OTTHUMP00000020351|androgen-induced growth factor|fibroblast growth factor 8
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com