Product Browser

Last updated: 2022/6/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FGF7 DNAxPab DNAxPab

  • Catalog # : H00002252-W01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human FGF7 DNA using DNAx™ Immune technology.
  • Immunogen:
  • Full-length human DNA
  • Sequence:
  • MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Purification:
  • Protein A
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunofluorescence (Transfected cell)
  • Flow Cytometry (Transfected cell)
  • Application Image
  • Western Blot (Transfected lysate)
  • Immunofluorescence (Transfected cell)
  • Flow Cytometry (Transfected cell)
  • Gene Information
  • Entrez GeneID:
  • 2252
  • Gene Name:
  • FGF7
  • Gene Alias:
  • HBGF-7,KGF
  • Gene Description:
  • fibroblast growth factor 7 (keratinocyte growth factor)
  • Gene Summary:
  • The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis. [provided by RefSeq
  • Other Designations:
  • fibroblast growth factor 7,heparin-binding growth factor 7,keratinocyte growth factor
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook