FGF5 monoclonal antibody (M01), clone 1B4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FGF5.
Immunogen
FGF5 (NP_004455.2, 159 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FGF5 monoclonal antibody (M01), clone 1B4. Western Blot analysis of FGF5 expression in human colon.Immunoprecipitation
Immunoprecipitation of FGF5 transfected lysate using anti-FGF5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FGF5 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FGF5 is 3 ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between FGFR2 and FGF5. HeLa cells were stained with anti-FGFR2 rabbit purified polyclonal 1:1200 and anti-FGF5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — FGF5
Entrez GeneID
2250GeneBank Accession#
NM_004464Protein Accession#
NP_004455.2Gene Name
FGF5
Gene Alias
HBGF-5, Smag-82
Gene Description
fibroblast growth factor 5
Omim ID
165190Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified as an oncogene, which confers transforming potential when transfected into mammalian cells. Targeted disruption of the homolog of this gene in mouse resulted in the phenotype of abnormally long hair, which suggested a function as an inhibitor of hair elongation. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
heparin-binding growth factor 5
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Evidence of post-transcriptional readthrough regulation in FGF5 gene of alpaca.
Pallotti S, Pediconi D, Subramanian D, Molina MG, Antonini M, Morelli MB, Renieri C, La Terza A.
Gene 2018 Mar; 647:121.
Application:WB, Sheep, Skin biopsies.
-
Evidence of post-transcriptional readthrough regulation in FGF5 gene of alpaca.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com