FGF5 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of FGF5 expression in transfected 293T cell line (H00002250-T01) by FGF5 MaxPab polyclonal antibody.
Lane 1: FGF5 transfected lysate(13.53 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to FGF5 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FGF5 protein.
Immunogen
FGF5 (NP_149134, 1 a.a. ~ 123 a.a) full-length human protein.
Sequence
MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSQVHR
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FGF5 expression in transfected 293T cell line (H00002250-T01) by FGF5 MaxPab polyclonal antibody.
Lane 1: FGF5 transfected lysate(13.53 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to FGF5 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — FGF5
Entrez GeneID
2250GeneBank Accession#
NM_033143Protein Accession#
NP_149134Gene Name
FGF5
Gene Alias
HBGF-5, Smag-82
Gene Description
fibroblast growth factor 5
Omim ID
165190Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified as an oncogene, which confers transforming potential when transfected into mammalian cells. Targeted disruption of the homolog of this gene in mouse resulted in the phenotype of abnormally long hair, which suggested a function as an inhibitor of hair elongation. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
heparin-binding growth factor 5
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com