FEN1 monoclonal antibody (M01A), clone 1E2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FEN1 monoclonal antibody (M01A), clone 1E2 Western Blot analysis of FEN1 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FEN1.
Immunogen
FEN1 (NP_004102, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQ
Host
Mouse
Reactivity
Human
Isotype
IgM Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FEN1 monoclonal antibody (M01A), clone 1E2 Western Blot analysis of FEN1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — FEN1
Entrez GeneID
2237GeneBank Accession#
NM_004111Protein Accession#
NP_004102Gene Name
FEN1
Gene Alias
FEN-1, MF1, RAD2
Gene Description
flap structure-specific endonuclease 1
Omim ID
600393Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene removes 5' overhanging flaps in DNA repair and processes the 5' ends of Okazaki fragments in lagging strand DNA synthesis. Direct physical interaction between this protein and AP endonuclease 1 during long-patch base excision repair provides coordinated loading of the proteins onto the substrate, thus passing the substrate from one enzyme to another. The protein is a member of the XPG/RAD2 endonuclease family and is one of ten proteins essential for cell-free DNA replication. DNA secondary structure can inhibit flap processing at certain trinucleotide repeats in a length-dependent manner by concealing the 5' end of the flap that is necessary for both binding and cleavage by the protein encoded by this gene. Therefore, secondary structure can deter the protective function of this protein, leading to site-specific trinucleotide expansions. [provided by RefSeq
Other Designations
DNase IV|maturation factor-1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com