Product Browser

Last updated: 2020/8/2

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FCN2 DNAxPab DNAxPab

  • Catalog # : H00002220-W01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human FCN2 DNA using DNAx™ Immune technology.
  • Immunogen:
  • FCN2 (NP_004099.2, 26 a.a. ~ 313 a.a) Full-length human DNA
  • Sequence:
  • LQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Purification:
  • Protein A
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunofluorescence (Transfected cell)
  • Immunofluorescence (Exosome)
  • Flow Cytometry (Transfected cell)
  • Application Image
  • Western Blot (Transfected lysate)
  • Immunofluorescence (Transfected cell)
  • Immunofluorescence (Exosome)
  • Flow Cytometry (Transfected cell)
  • Gene Information
  • Entrez GeneID:
  • 2220
  • Gene Name:
  • FCN2
  • Gene Alias:
  • EBP-37,FCNL,P35,ficolin-2
  • Gene Description:
  • ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin)
  • Gene Summary:
  • The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is predominantly expressed in the liver, and has been shown to have carbohydrate binding and opsonic activities. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • L-ficolin,OTTHUMP00000022518,collagen/fibrinogen domain-containing protein 2,ficolin 2,ficolin B,hucolin,serum lectin p35
  • RSS
  • YouTube
  • Linkedin
  • Facebook