Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FCN2 mouse monoclonal antibody (hybridoma)

  • Catalog # : H00002220-M
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant FCN2.
  • Immunogen:
  • FCN2 (NP_004099.2, 1 a.a. ~ 313 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactivity and specificity confirmed by ELISA and Western Blot.
  • Note:
  • Customer should check the viability of the hybridomas within one month from the date of receipt. Fee-for-service of long term hybridoma storage can be performed upon customer's request.
  • Deliverables:
  • Up to 5 positive hybridoma clones will be delivered to customer in the cryotube format.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2220
  • Gene Name:
  • FCN2
  • Gene Alias:
  • EBP-37,FCNL,P35,ficolin-2
  • Gene Description:
  • ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin)
  • Gene Summary:
  • The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is predominantly expressed in the liver, and has been shown to have carbohydrate binding and opsonic activities. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • L-ficolin,OTTHUMP00000022518,collagen/fibrinogen domain-containing protein 2,ficolin 2,ficolin B,hucolin,serum lectin p35
  • RSS
  • YouTube
  • Linkedin
  • Facebook