FCN2 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
FCN2 MaxPab rabbit polyclonal antibody. Western Blot analysis of FCN2 expression in human colon.
Western Blot (Transfected lysate)
Western Blot analysis of FCN2 expression in transfected 293T cell line (H00002220-T02) by FCN2 MaxPab polyclonal antibody.
Lane 1: FCN2 transfected lysate(34.00 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of FCN2 transfected lysate using anti-FCN2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with FCN2 purified MaxPab mouse polyclonal antibody (B01P) (H00002220-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human FCN2 protein.
Immunogen
FCN2 (NP_004099.2, 1 a.a. ~ 313 a.a) full-length human protein.
Sequence
MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FCN2 MaxPab rabbit polyclonal antibody. Western Blot analysis of FCN2 expression in human colon.Western Blot (Transfected lysate)
Western Blot analysis of FCN2 expression in transfected 293T cell line (H00002220-T02) by FCN2 MaxPab polyclonal antibody.
Lane 1: FCN2 transfected lysate(34.00 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of FCN2 transfected lysate using anti-FCN2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with FCN2 purified MaxPab mouse polyclonal antibody (B01P) (H00002220-B01P). -
Gene Info — FCN2
Entrez GeneID
2220GeneBank Accession#
BC069825Protein Accession#
NP_004099.2Gene Name
FCN2
Gene Alias
EBP-37, FCNL, P35, ficolin-2
Gene Description
ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin)
Omim ID
601624Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is predominantly expressed in the liver, and has been shown to have carbohydrate binding and opsonic activities. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
L-ficolin|OTTHUMP00000022518|collagen/fibrinogen domain-containing protein 2|ficolin 2|ficolin B|hucolin|serum lectin p35
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com