FCN1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of FCN1 expression in transfected 293T cell line (H00002219-T01) by FCN1 MaxPab polyclonal antibody.
Lane 1: FCN1 transfected lysate(35.10 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human FCN1 protein.
Immunogen
FCN1 (NP_001994.2, 1 a.a. ~ 326 a.a) full-length human protein.
Sequence
MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FCN1 expression in transfected 293T cell line (H00002219-T01) by FCN1 MaxPab polyclonal antibody.
Lane 1: FCN1 transfected lysate(35.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FCN1
Entrez GeneID
2219GeneBank Accession#
NM_002003.2Protein Accession#
NP_001994.2Gene Name
FCN1
Gene Alias
FCNM
Gene Description
ficolin (collagen/fibrinogen domain containing) 1
Omim ID
601252Gene Ontology
HyperlinkGene Summary
The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein C1q, C-type lectins known as collectins, and tenascins. However, all these proteins recognize different targets, and are functionally distinct. Ficolin 1 encoded by FCN1 is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity. [provided by RefSeq
Other Designations
OTTHUMP00000022519|ficolin (collagen/fibrinogen domain-containing) 1|ficolin 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com