Product Browser

Last updated: 2017/7/16

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FCGR3A (Human) Recombinant Protein (P01)

  • Catalog # : H00002214-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FCGR3A full-length ORF ( AAH17865.1, 17 a.a. - 254 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKDPQDK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 51.92
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002214-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2214
  • Gene Name:
  • FCGR3A
  • Gene Alias:
  • CD16,CD16A,FCG3,FCGR3,FCGRIII,FCR-10,FCRIII,FCRIIIA,IGFR3
  • Gene Description:
  • Fc fragment of IgG, low affinity IIIa, receptor (CD16a)
  • Gene Summary:
  • This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other other antibody-dependent responses. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Fc fragment of IgG, low affinity III, receptor for (CD16),Fc fragment of IgG, low affinity IIIa, receptor for (CD16),Fc gamma receptor III-A,Fc-gamma RIII-alpha,Fc-gamma RIIIa,Fc-gamma receptor III-2 (CD 16),Fc-gamma receptor IIIb (CD16),FcgammaRIIIA,OTTH
  • Interactome
  • Interactome
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook