Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FCGR3A monoclonal antibody (M03), clone 2B11

  • Catalog # : H00002214-M03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant FCGR3A.
  • Immunogen:
  • FCGR3A (AAH17865.1, 17 a.a. ~ 254 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKDPQDK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002214-M03
    Western Blot detection against Immunogen (51.92 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FCGR3A monoclonal antibody (M03), clone 2B11. Western Blot analysis of FCGR3A expression in Jurkat ( Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged FCGR3A is approximately 1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2214
  • Gene Name:
  • FCGR3A
  • Gene Alias:
  • CD16,CD16A,FCG3,FCGR3,FCGRIII,FCR-10,FCRIII,FCRIIIA,IGFR3
  • Gene Description:
  • Fc fragment of IgG, low affinity IIIa, receptor (CD16a)
  • Gene Summary:
  • This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other other antibody-dependent responses. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Fc fragment of IgG, low affinity III, receptor for (CD16),Fc fragment of IgG, low affinity IIIa, receptor for (CD16),Fc gamma receptor III-A,Fc-gamma RIII-alpha,Fc-gamma RIIIa,Fc-gamma receptor III-2 (CD 16),Fc-gamma receptor IIIb (CD16),FcgammaRIIIA,OTTH
  • Interactome
  • Interactome
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook