Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FCGR2A (Human) Recombinant Protein (Q01)

  • Catalog # : H00002212-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FCGR2A partial ORF ( AAH20823, 46 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.29
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002212-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2212
  • Gene Name:
  • FCGR2A
  • Gene Alias:
  • CD32,CD32A,CDw32,FCG2,FCGR2,FCGR2A1,FcGR,IGFR2,MGC23887,MGC30032
  • Gene Description:
  • Fc fragment of IgG, low affinity IIa, receptor (CD32)
  • Gene Summary:
  • This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • Fc fragment of IgG, low affinity IIa, receptor,Fc fragment of IgG, low affinity IIa, receptor for (CD32),Immunoglobulin G Fc receptor II,OTTHUMP00000032377
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook