FCGR1A (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FCGR1A partial ORF ( NP_000557, 16 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FCGR1A
Entrez GeneID
2209GeneBank Accession#
NM_000566Protein Accession#
NP_000557Gene Name
FCGR1A
Gene Alias
CD64, CD64A, FCRI, FLJ18345, IGFR1
Gene Description
Fc fragment of IgG, high affinity Ia, receptor (CD64)
Omim ID
146760Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1. [provided by RefSeq
Other Designations
Fc fragment of IgG, high affinity Ia, receptor for (CD64)|Fc gamma receptor|Fc-gamma RI|Fc-gamma receptor I A1|IgG Fc receptor I|OTTHUMP00000013913
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Discovery and characterization of a peptide motif that specifically recognizes a non-native conformation of human IGG induced by acidic ph conditions.
Sakamoto K, Ito Y, Hatanaka T, Soni PB, Mori T, Sugimura K.
The Journal of Biological Chemistry 2009 Apr; 284(15):9986.
Application:Func, Receptor.
-
Discovery and characterization of a peptide motif that specifically recognizes a non-native conformation of human IGG induced by acidic ph conditions.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com