FCGR1A monoclonal antibody (M01), clone 1D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FCGR1A is approximately 1ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between FCGR3A and FCGR1A. HeLa cells were stained with anti-FCGR3A rabbit purified polyclonal 1:1200 and anti-FCGR1A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FCGR1A.
Immunogen
FCGR1A (NP_000557, 16 a.a. ~ 115 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFT
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FCGR1A is approximately 1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between FCGR3A and FCGR1A. HeLa cells were stained with anti-FCGR3A rabbit purified polyclonal 1:1200 and anti-FCGR1A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — FCGR1A
Entrez GeneID
2209GeneBank Accession#
NM_000566Protein Accession#
NP_000557Gene Name
FCGR1A
Gene Alias
CD64, CD64A, FCRI, FLJ18345, IGFR1
Gene Description
Fc fragment of IgG, high affinity Ia, receptor (CD64)
Omim ID
146760Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1. [provided by RefSeq
Other Designations
Fc fragment of IgG, high affinity Ia, receptor for (CD64)|Fc gamma receptor|Fc-gamma RI|Fc-gamma receptor I A1|IgG Fc receptor I|OTTHUMP00000013913
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Selective Antibody Intervention of Toll-like Receptor 4 Activation through Fc γ Receptor Tethering.
Shang L, Daubeuf B, Triantafilou M, Olden R, Depis F, Raby AC, Herren S, Dos Santos A, Malinge P, Dunn-Siegrist I, Benmkaddem S, Geinoz A, Magistrelli G, Rousseau F, Buatois V, Salgado-Pires S, Reith W, Monteiro R, Pugin J, Leger O, Ferlin W, Kosco-Vilbois M, Triantafilou K, Elson G.
The Journal of Biological Chemistry 2014 May; 289(22):15309.
Application：FRET, IF, Human, THP-1 cells.
-
Selective Antibody Intervention of Toll-like Receptor 4 Activation through Fc γ Receptor Tethering.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com