Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FCER2 (Human) Recombinant ProteinProteoliposome

  • Catalog # : H00002208-G01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FCER2 full-length ORF (NP_001993.2) recombinant protein without tag.
  • Sequence:
  • MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.5
  • Form:
  • Liquid
  • Recommend Usage:
  • Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
  • Storage Buffer:
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Antibody Production
  • Functional Study
  • Recommended usage only, not validated yet.
  • Compound Screening
  • Recommended usage only, not validated yet.
  • Application Image
  • Antibody Production
  • Functional Study
  • Compound Screening
  • Gene Information
  • Entrez GeneID:
  • 2208
  • Gene Name:
  • FCER2
  • Gene Alias:
  • CD23,CD23A,CLEC4J,FCE2,IGEBF
  • Gene Description:
  • Fc fragment of IgE, low affinity II, receptor for (CD23)
  • Gene Summary:
  • The human leukocyte differentiation antigen CD23 (FCE2) is a key molecule for B-cell activation and growth. It is the low-affinity receptor for IgE. The truncated molecule can be secreted, then functioning as a potent mitogenic growth factor.[supplied by OMIM
  • Other Designations:
  • C-type lectin domain family 4, member J,CD23 antigen,Fc fragment of IgE, low affinity II, receptor for (CD23A)
  • RSS
  • YouTube
  • Linkedin
  • Facebook