Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FARSLA (Human) Recombinant Protein (Q01)

  • Catalog # : H00002193-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FARSLA partial ORF ( NP_004452, 101 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KVGFSKAMSNKWIRVDKSAADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.85
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002193-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2193
  • Gene Name:
  • FARSA
  • Gene Alias:
  • CML33,FARSL,FARSLA,FRSA,PheHA
  • Gene Description:
  • phenylalanyl-tRNA synthetase, alpha subunit
  • Gene Summary:
  • Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. This gene encodes a product which is similar to the catalytic subunit of prokaryotic and Saccharomyces cerevisiae phenylalanyl-tRNA synthetases (PheRS). This gene product has been shown to be expressed in a tumor-selective and cell cycle stage- and differentiation-dependent manner, the first member of the tRNA synthetase gene family shown to exhibit this type of regulated expression [provided by RefSeq
  • Other Designations:
  • phenylalanine tRNA ligase 1, alpha, cytoplasmic,phenylalanine-tRNA synthetase alpha-subunit,phenylalanine-tRNA synthetase-like, alpha subunit,phenylalanyl-tRNA synthetase-like, alpha subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook