Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FARSLA monoclonal antibody (M01), clone 2D8

  • Catalog # : H00002193-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant FARSLA.
  • Immunogen:
  • FARSLA (NP_004452, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • KVGFSKAMSNKWIRVDKSAADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002193-M01
    Western Blot detection against Immunogen (36.85 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FARSLA monoclonal antibody (M01), clone 2D8 Western Blot analysis of FARSLA expression in MCF-7 ( Cat # L046V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2193
  • Gene Name:
  • FARSA
  • Gene Alias:
  • CML33,FARSL,FARSLA,FRSA,PheHA
  • Gene Description:
  • phenylalanyl-tRNA synthetase, alpha subunit
  • Gene Summary:
  • Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. This gene encodes a product which is similar to the catalytic subunit of prokaryotic and Saccharomyces cerevisiae phenylalanyl-tRNA synthetases (PheRS). This gene product has been shown to be expressed in a tumor-selective and cell cycle stage- and differentiation-dependent manner, the first member of the tRNA synthetase gene family shown to exhibit this type of regulated expression [provided by RefSeq
  • Other Designations:
  • phenylalanine tRNA ligase 1, alpha, cytoplasmic,phenylalanine-tRNA synthetase alpha-subunit,phenylalanine-tRNA synthetase-like, alpha subunit,phenylalanyl-tRNA synthetase-like, alpha subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook