FARSLA polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FARSLA polyclonal antibody (A01), Lot # 060102JC01. Western Blot analysis of FARSLA expression in PC-12.
Western Blot (Cell lysate)
FARSLA polyclonal antibody (A01), Lot # 060102JC01. Western Blot analysis of FARSLA expression in NIH/3T3.
Western Blot (Cell lysate)
FARSLA polyclonal antibody (A01), Lot # 060102JC01 Western Blot analysis of FARSLA expression in Jurkat ( Cat # L017V1 ).
Western Blot (Cell lysate)
FARSLA polyclonal antibody (A01), Lot # 060102JC01. Western Blot analysis of FARSLA expression in Raw 264.7.
Western Blot detection against Immunogen (37.22 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant FARSLA.
Immunogen
FARSLA (NP_004452, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag.
Sequence
KVGFSKAMSNKWIRVDKSAADGPRVFRVVDSMEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGS
Host
Mouse
Reactivity
Human, Mouse, Rat
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.22 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FARSLA polyclonal antibody (A01), Lot # 060102JC01. Western Blot analysis of FARSLA expression in PC-12.Western Blot (Cell lysate)
FARSLA polyclonal antibody (A01), Lot # 060102JC01. Western Blot analysis of FARSLA expression in NIH/3T3.Western Blot (Cell lysate)
FARSLA polyclonal antibody (A01), Lot # 060102JC01 Western Blot analysis of FARSLA expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
FARSLA polyclonal antibody (A01), Lot # 060102JC01. Western Blot analysis of FARSLA expression in Raw 264.7.Western Blot (Recombinant protein)
ELISA
-
Gene Info — FARSA
Entrez GeneID
2193GeneBank Accession#
NM_004461Protein Accession#
NP_004452Gene Name
FARSA
Gene Alias
CML33, FARSL, FARSLA, FRSA, PheHA
Gene Description
phenylalanyl-tRNA synthetase, alpha subunit
Omim ID
602918Gene Ontology
HyperlinkGene Summary
Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. This gene encodes a product which is similar to the catalytic subunit of prokaryotic and Saccharomyces cerevisiae phenylalanyl-tRNA synthetases (PheRS). This gene product has been shown to be expressed in a tumor-selective and cell cycle stage- and differentiation-dependent manner, the first member of the tRNA synthetase gene family shown to exhibit this type of regulated expression [provided by RefSeq
Other Designations
phenylalanine tRNA ligase 1, alpha, cytoplasmic|phenylalanine-tRNA synthetase alpha-subunit|phenylalanine-tRNA synthetase-like, alpha subunit|phenylalanyl-tRNA synthetase-like, alpha subunit
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com