FANCF purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FANCF protein.
Immunogen
FANCF (NP_073562.1, 1 a.a. ~ 374 a.a) full-length human protein.
Sequence
MESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGRHGPIRTALERRLHNQWRQEGGFGRGPVPGLANFQALGHCDVLLSLRLLENRALGDAARYHLVQQLFPGPGVRDADEETLQESLARLARRRSAVHMLRFNGYRENPNLQEDSLMKTQAELLLERLQEVGKAEAERPARFLSSLWERLPQNNFLKVIAVALLQPPLSRRPQEELEPGIHKSPGEGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSGAFRKRQVLGLSAGLSSV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (49); Rat (53)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FANCF expression in transfected 293T cell line (H00002188-T01) by FANCF MaxPab polyclonal antibody.
Lane 1: FANCF transfected lysate(41.14 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to FANCF on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — FANCF
Entrez GeneID
2188GeneBank Accession#
NM_022725.2Protein Accession#
NP_073562.1Gene Name
FANCF
Gene Alias
FAF, MGC126856
Gene Description
Fanconi anemia, complementation group F
Omim ID
603467Gene Ontology
HyperlinkGene Summary
The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group F. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
MicroRNA regulation of endothelial TREX1 reprograms the tumour microenvironment.
Wilson R, Espinosa-Diez C, Kanner N, Chatterjee N, Ruhl R, Hipfinger C, Advani SJ, Li J, Khan OF, Franovic A, Weis SM, Kumar S, Coussens LM, Anderson DG, Chen CC, Cheresh DA, Anand S.
Nature Communications 2016 Nov; 7:13597.
Application:WB-Tr, Human, HUVEC.
-
MicroRNA regulation of endothelial TREX1 reprograms the tumour microenvironment.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com