ACSL3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ACSL3 polyclonal antibody (A01), Lot # 051220JC01 Western Blot analysis of ACSL3 expression in 293 ( Cat # L026V1 ).
Western Blot detection against Immunogen (35.57 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant ACSL3.
Immunogen
ACSL3 (NP_004448, 203 a.a. ~ 288 a.a) partial recombinant protein with GST tag.
Sequence
NETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIMYTS
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.57 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ACSL3 polyclonal antibody (A01), Lot # 051220JC01 Western Blot analysis of ACSL3 expression in 293 ( Cat # L026V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — ACSL3
Entrez GeneID
2181GeneBank Accession#
NM_004457Protein Accession#
NP_004448Gene Name
ACSL3
Gene Alias
ACS3, FACL3, PRO2194
Gene Description
acyl-CoA synthetase long-chain family member 3
Omim ID
602371Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000164212|fatty-acid-Coenzyme A ligase, long-chain 3|lignoceroyl-CoA synthase
-
Interactome
-
Pathway
-
Publication Reference
-
Increased Long Chain acyl-Coa Synthetase Activity and Fatty Acid Import Is Linked to Membrane Synthesis for Development of Picornavirus Replication Organelles.
Nchoutmboube JA, Viktorova EG, Scott AJ, Ford LA, Pei Z, Watkins PA, Ernst RK, Belov GA.
PLoS Pathogens 2013 Jun; 9(6):e1003401.
Application：WB-Tr, Human, HeLa cells.
-
Increased Long Chain acyl-Coa Synthetase Activity and Fatty Acid Import Is Linked to Membrane Synthesis for Development of Picornavirus Replication Organelles.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com