Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ACSL1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002180-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ACSL1 partial ORF ( NP_001986, 48 a.a. - 145 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.52
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002180-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2180
  • Gene Name:
  • ACSL1
  • Gene Alias:
  • ACS1,FACL1,FACL2,LACS,LACS1,LACS2
  • Gene Description:
  • acyl-CoA synthetase long-chain family member 1
  • Gene Summary:
  • The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. [provided by RefSeq
  • Other Designations:
  • fatty-acid-Coenzyme A ligase, long-chain 1,fatty-acid-Coenzyme A ligase, long-chain 2,lignoceroyl-CoA synthase,long-chain acyl-CoA synthetase 1,long-chain acyl-CoA synthetase 2,long-chain fatty-acid-coenzyme A ligase 1,palmitoyl-CoA ligase 2,paltimoyl-CoA
  • RSS
  • YouTube
  • Linkedin
  • Facebook