Product Browser

Last updated: 2017/1/22
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FABP7 polyclonal antibody (A01)

  • Catalog # : H00002173-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant FABP7.
  • Immunogen:
  • FABP7 (AAH12299, 1 a.a. ~ 132 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002173-A01
    Western Blot detection against Immunogen (40.63 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2173
  • Gene Name:
  • FABP7
  • Gene Alias:
  • B-FABP,BLBP,DKFZp547J2313,FABPB,MRG
  • Gene Description:
  • fatty acid binding protein 7, brain
  • Gene Summary:
  • The protein encoded by this gene is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000017118,brain lipid binding protein,mammary-derived growth inhibitor-related
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook