Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FABP6 (Human) Recombinant Protein (P01)

  • Catalog # : H00002172-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FABP6 full-length ORF ( AAH22489, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 39.82
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002172-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2172
  • Gene Name:
  • FABP6
  • Gene Alias:
  • I-15P,I-BABP,I-BALB,I-BAP,ILBP,ILBP3,ILLBP
  • Gene Description:
  • fatty acid binding protein 6, ileal
  • Gene Summary:
  • This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000160846,gastrotropin,ileal bile acid binding protein,illeal lipid-binding protein
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook