Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Pathway

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FABP6 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00002172-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human FABP6 protein.
  • Immunogen:
  • FABP6 (NP_001436.1, 1 a.a. ~ 128 a.a) full-length human protein.
  • Sequence:
  • MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FABP6 expression in transfected 293T cell line (H00002172-T03) by FABP6 MaxPab polyclonal antibody.

    Lane 1: FABP6 transfected lysate(14.40 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2172
  • Gene Name:
  • FABP6
  • Gene Alias:
  • I-15P,I-BABP,I-BALB,I-BAP,ILBP,ILBP3,ILLBP
  • Gene Description:
  • fatty acid binding protein 6, ileal
  • Gene Summary:
  • This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000160846,gastrotropin,ileal bile acid binding protein,illeal lipid-binding protein
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook