Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FABP5 purified MaxPab mouse polyclonal antibody (B03P)MaxPab

  • Catalog # : H00002171-B03P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human FABP5 protein.
  • Immunogen:
  • FABP5 (AAH19385, 1 a.a. ~ 135 a.a) full-length human protein.
  • Sequence:
  • MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRITQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FABP5 expression in transfected 293T cell line (H00002171-T05) by FABP5 MaxPab polyclonal antibody.

    Lane 1: FABP5 transfected lysate(14.96 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2171
  • Gene Name:
  • FABP5
  • Gene Alias:
  • E-FABP,EFABP,PA-FABP,PAFABP
  • Gene Description:
  • fatty acid binding protein 5 (psoriasis-associated)
  • Gene Summary:
  • This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. The human genome contains many pseudogenes similar to this locus. [provided by RefSeq
  • Other Designations:
  • -
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook