F9 monoclonal antibody (M01), clone 2C9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant F9.
Immunogen
F9 (NP_000124, 96 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLT
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of F9 expression in transfected 293T cell line by F9 monoclonal antibody (M01), clone 2C9.
Lane 1: F9 transfected lysate(51.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of F9 transfected lysate using anti-F9 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with F9 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged F9 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of F9 over-expressed 293 cell line, cotransfected with F9 Validated Chimera RNAi ( Cat # H00002158-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with F9 monoclonal antibody (M01), clone 2C9 (Cat # H00002158-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — F9
Entrez GeneID
2158GeneBank Accession#
NM_000133Protein Accession#
NP_000124Gene Name
F9
Gene Alias
FIX, HEMB, MGC129641, MGC129642, PTC
Gene Description
coagulation factor IX
Omim ID
306900Gene Ontology
HyperlinkGene Summary
This gene encodes vitamin K-dependent coagulation factor IX that circulates in the blood as an inactive zymogen. This factor is converted to an active form by factor XIa, which excises the activation peptide and thus generates a heavy chain and a light chain held together by one or more disulfide bonds. The role of this activated factor IX in the blood coagulation cascade is to activate factor X to its active form through interactions with Ca+2 ions, membrane phospholipids, and factor VIII. Alterations of this gene, including point mutations, insertions and deletions, cause factor IX deficiency, which is a recessive X-linked disorder, also called hemophilia B or Christmas disease. [provided by RefSeq
Other Designations
Christmas factor|OTTHUMP00000024154|coagulant factor IX|factor 9|factor IX|plasma thromboplastic component
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Pathological mechanism and antisense oligonucleotide-mediated rescue of a non-coding variant suppressing factor 9 RNA biogenesis leading to hemophilia B.
Krooss S, Werwitzke S, Kopp J, Rovai A, Varnholt D, Wachs AS, Goyenvalle A, Aarstma-Rus A, Ott M, Tiede A, Langemeier J, Bohne J.
PLoS Genetics 2020 Apr; 16(4):e1008690.
Application:WB-Tr, Human, Mouse, HEK293T, CHO cells.
-
Pathological mechanism and antisense oligonucleotide-mediated rescue of a non-coding variant suppressing factor 9 RNA biogenesis leading to hemophilia B.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com