EZH2 monoclonal antibody (M01), clone 2C3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EZH2.
Immunogen
EZH2 (AAH10858, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIM
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EZH2 monoclonal antibody ( M01 ) , clone 2C3 recognizes the appropriate size ( 95 KDa ) full length protein in human prostrate cancer cells ( DU145, whole cell extract made in modified RIPA buffer ) , Primary Ab dilution = 1 : 1000. Mouse-HRPO dilution = 1 : 25000.Western Blot (Recombinant protein)
ELISA
-
Gene Info — EZH2
Entrez GeneID
2146GeneBank Accession#
BC010858Protein Accession#
AAH10858Gene Name
EZH2
Gene Alias
ENX-1, EZH1, KMT6, MGC9169
Gene Description
enhancer of zeste homolog 2 (Drosophila)
Omim ID
601573Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
enhancer of zeste 2
-
Interactome
-
Disease
-
Publication Reference
-
Monospecific antibody targeting of CDH11 inhibits epithelial-to-mesenchymal transition and represses cancer stem cell-like phenotype by up-regulating miR-335 in metastatic breast cancer, in vitro and in vivo.
Chen JH, Huang WC, Bamodu OA, Chang PM, Chao TY, Huang TH.
BMC Cancer 2019 Jun; 19(1):634.
Application:WB-Ce, WB-Tr, Human, Cancer-associated fibroblasts, MCF-7, MDA-MB-231 cells.
-
Cardiogenol C can induce Mouse Hair Bulge Progenitor Cells to Transdifferentiate into Cardiomyocyte-like Cells.
Yau WW, Tang MK, Chen E, Yao Y, Wong IW, Lee HS, Lee KK.
Proteome Science 2011 Jan; 9(1):3.
Application:WB-Ce, Mouse, Mouse hair bulge progenitor cells.
-
Monospecific antibody targeting of CDH11 inhibits epithelial-to-mesenchymal transition and represses cancer stem cell-like phenotype by up-regulating miR-335 in metastatic breast cancer, in vitro and in vivo.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com