EYA2 monoclonal antibody (M04), clone 2F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EYA2.
Immunogen
EYA2 (NP_742108, 164 a.a. ~ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.99 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EYA2 monoclonal antibody (M04), clone 2F8 Western Blot analysis of EYA2 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Transfected lysate)
Western Blot analysis of EYA2 expression in transfected 293T cell line by EYA2 monoclonal antibody (M04), clone 2F8.
Lane 1: EYA2 transfected lysate(59.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to EYA2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — EYA2
Entrez GeneID
2139GeneBank Accession#
NM_172110Protein Accession#
NP_742108Gene Name
EYA2
Gene Alias
EAB1, MGC10614
Gene Description
eyes absent homolog 2 (Drosophila)
Omim ID
601654Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may be post-translationally modified and may play a role in eye development. A similar protein in mice can act as a transcriptional activator. Alternative splicing results in multiple transcript variants, but the full-length natures of all of these variants have not yet been determined. [provided by RefSeq
Other Designations
OTTHUMP00000031666|eyes absent 2|translation of this uORF probably lowers the translation efficiency of EYA2
-
Interactome
-
Disease
-
Publication Reference
-
A FBXO7/EYA2-SCF FBXW7 axis promotes AXL-mediated maintenance of mesenchymal and immune evasion phenotypes of cancer cells.
Jia Z Shen, Zhixin Qiu, Qiulian Wu, Guoxin Zhang, Rebecca Harris, Dahui Sun, Juha Rantala, William D Barshop, Linjie Zhao, Deguan Lv, Kwang-Ai Won, James Wohlschlegel, Olle Sangfelt, Heike Laman, Jeremy N Rich, Charles Spruck.
Molecular Cell 2022 Mar; 82(6):1123.
Application:Co-IP, Human, HEK 293T (Bosc 23) cells.
-
A FBXO7/EYA2-SCF FBXW7 axis promotes AXL-mediated maintenance of mesenchymal and immune evasion phenotypes of cancer cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com