Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EYA1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002138-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EYA1 partial ORF ( NP_000494, 100 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTEGGLSQSQSPGQTGFLSYGTSF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.55
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002138-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2138
  • Gene Name:
  • EYA1
  • Gene Alias:
  • BOP,BOR,MGC141875
  • Gene Description:
  • eyes absent homolog 1 (Drosophila)
  • Gene Summary:
  • This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may play a role in the developing kidney, branchial arches, eye, and ear. Mutations of this gene have been associated with branchiootorenal dysplasia syndrome, branchiootic syndrome, and sporadic cases of congenital cataracts and ocular anterior segment anomalies. A similar protein in mice can act as a transcriptional activator. Four transcript variants encoding three distinct isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • Eyes absent, Drosophila, homolog of, 1,Melnick-Fraser syndrome,OTTHUMP00000195053,eyes absent 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook