EYA1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
EYA1 polyclonal antibody (A01), Lot # 060703JCS1 Western Blot analysis of EYA1 expression in Jurkat ( Cat # L017V1 ).
Western Blot detection against Immunogen (33.92 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant EYA1.
Immunogen
EYA1 (NP_000494, 100 a.a. ~ 170 a.a) partial recombinant protein with GST tag.
Sequence
TPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTEGGLSQSQSPGQTGFLSYGTSF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.92 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EYA1 polyclonal antibody (A01), Lot # 060703JCS1 Western Blot analysis of EYA1 expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — EYA1
Entrez GeneID
2138GeneBank Accession#
NM_000503Protein Accession#
NP_000494Gene Name
EYA1
Gene Alias
BOP, BOR, MGC141875
Gene Description
eyes absent homolog 1 (Drosophila)
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may play a role in the developing kidney, branchial arches, eye, and ear. Mutations of this gene have been associated with branchiootorenal dysplasia syndrome, branchiootic syndrome, and sporadic cases of congenital cataracts and ocular anterior segment anomalies. A similar protein in mice can act as a transcriptional activator. Four transcript variants encoding three distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
Eyes absent, Drosophila, homolog of, 1|Melnick-Fraser syndrome|OTTHUMP00000195053|eyes absent 1
-
Interactome
-
Disease
-
Publication Reference
-
Gene signatures associated with mouse postnatal hindbrain neural stem cells and medulloblastoma cancer stem cells identify novel molecular mediators and predict human medulloblastoma molecular classification.
Corno D, Pala M, Cominelli M, Cipelletti B, Leto K, Croci L, Barili V, Brandalise F, Melzi R, Di Gregorio A, Sergi LS, Politi LS, Piemonti L, Bulfone A, Rossi P, Rossi F, Consalez GG, Poliani PL, Galli R.
Cancer Discovery 2012 Jun; 2(6):554.
Application：WB-Ti, Mouse, NSCs, medulloblastoma CSCs, and medulloblastoma tissues.
-
Eyes absent 1 (Eya1) is a critical coordinator of epithelial, mesenchymal and vascular morphogenesis in the mammalian lung.
El-Hashash AH, Al Alam D, Turcatel G, Bellusci S, Warburton D.
Developmental Biology 2011 Feb; 350(1):112.
Application：IHC, Mouse, Lung, MLE-15 cells.
-
Gene signatures associated with mouse postnatal hindbrain neural stem cells and medulloblastoma cancer stem cells identify novel molecular mediators and predict human medulloblastoma molecular classification.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com