ETV5 monoclonal antibody (M02), clone 7C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ETV5.
Immunogen
ETV5 (NP_004445, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPM
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (95); Rat (93)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ETV5 monoclonal antibody (M02), clone 7C10. Western Blot analysis of ETV5 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
ETV5 monoclonal antibody (M02), clone 7C10 Western Blot analysis of ETV5 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
ETV5 monoclonal antibody (M02), clone 7C10. Western Blot analysis of ETV5 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
ETV5 monoclonal antibody (M02), clone 7C10. Western Blot analysis of ETV5 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ETV5 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — ETV5
-
Interactome
-
Disease
-
Publication Reference
-
Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor.
Lu G, Zhang Q, Huang Y, Song J, Tomaino R, Ehrenberger T, Lim E, Liu W, Bronson RT, Bowden M, Brock J, Krop IE, Dillon DA, Gygi SP, Mills GB, Richardson AL, Signoretti S, Yaffe MB, Kaelin WG Jr.
Cancer Cell 2014 Aug; 26(2):222.
Application:WB, Human, HCT116, MDA-MB-231 cells.
-
Cyclin D1 enhances the response to estrogen and progesterone by regulating progesterone receptor expression.
Yang C, Chen L, Li C, Lynch MC, Brisken C, Schmidt EV.
Molecular and Cellular Biology 2010 Jun; 30(12):3111.
Application:WB-Ti, Mouse, Mouse mammary tissues.
-
Characterization of TMPRSS2:ETV5 and SLC45A3:ETV5 gene fusions in prostate cancer.
Helgeson BE, Tomlins SA, Shah N, Laxman B, Cao Q, Prensner JR, Cao X, Singla N, Montie JE, Varambally S, Mehra R, Chinnaiyan AM.
Cancer Research 2008 Jan; 68(1):73.
Application:WB, Human, Immortalized prostate cell line RWPE.
-
Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com