ETF1 monoclonal antibody (M02), clone 2H4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ETF1 monoclonal antibody (M02), clone 2H4. Western Blot analysis of ETF1 expression in HepG2 ( Cat # L019V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of ETF1 expression in transfected 293T cell line by ETF1 monoclonal antibody (M02), clone 2H4.
Lane 1: ETF1 transfected lysate (Predicted MW: 49 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ETF1 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ETF1.
Immunogen
ETF1 (NP_004721.1, 338 a.a. ~ 437 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ETF1 monoclonal antibody (M02), clone 2H4. Western Blot analysis of ETF1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ETF1 expression in transfected 293T cell line by ETF1 monoclonal antibody (M02), clone 2H4.
Lane 1: ETF1 transfected lysate (Predicted MW: 49 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ETF1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — ETF1
Entrez GeneID
2107GeneBank Accession#
NM_004730Protein Accession#
NP_004721.1Gene Name
ETF1
Gene Alias
D5S1995, ERF, ERF1, MGC111066, RF1, SUP45L1, TB3-1
Gene Description
eukaryotic translation termination factor 1
Omim ID
600285Gene Ontology
HyperlinkGene Summary
Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP. A class 1 RF recognizes the stop codon and promotes the hydrolysis of the ester bond linking the polypeptide chain with the peptidyl site tRNA, a reaction catalyzed at the peptidyl transferase center of the ribosome. Class 2 RFs, which are not codon specific and do not recognize codons, stimulate class 1 RF activity and confer GTP dependency upon the process. In prokaryotes, both class 1 RFs, RF1 and RF2, recognize UAA; however, UAG and UGA are decoded specifically by RF1 and RF2, respectively. In eukaryotes, eRF1, or ETF1, the functional counterpart of RF1 and RF2, functions as an omnipotent RF, decoding all 3 stop codons (Frolova et al., 1994 [PubMed 7990965]).[supplied by OMIM
Other Designations
polypeptide chain release factor 1|sup45 (yeast omnipotent suppressor 45) homolog-like 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com