ERCC2 monoclonal antibody (M01J), clone 4G2-2A6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant ERCC2.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
ERCC2 (AAH08346, 1 a.a. ~ 405 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGQAQHCGSSRNQKRSHP
Host
Mouse
Reactivity
Human
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (70.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ERCC2 monoclonal antibody (M01J), clone 4G2-2A6. Western Blot analysis of ERCC2 expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of ERCC2 expression in transfected 293T cell line by ERCC2 monoclonal antibody (M01J), clone 4G2-2A6.
Lane 1: ERCC2 transfected lysate (Predicted MW: 86.9000000 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ERCC2 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — ERCC2
Entrez GeneID
2068GeneBank Accession#
BC008346Protein Accession#
AAH08346Gene Name
ERCC2
Gene Alias
COFS2, EM9, MGC102762, MGC126218, MGC126219, TTD, XPD
Gene Description
excision repair cross-complementing rodent repair deficiency, complementation group 2
Gene Ontology
HyperlinkGene Summary
The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
excision repair cross-complementing rodent repair deficiency, complementation group 2 protein|xeroderma pigmentosum complementary group D
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com