ERBB4 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ERBB4 partial ORF ( NP_005226, 26 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
QSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ERBB4
Entrez GeneID
2066GeneBank Accession#
NM_005235Protein Accession#
NP_005226Gene Name
ERBB4
Gene Alias
HER4, MGC138404, p180erbB4
Gene Description
v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian)
Omim ID
600543Gene Ontology
HyperlinkGene Summary
This gene is a member of the Tyr protein kinase family and the epidermal growth factor receptor subfamily. It encodes a single-pass type I membrane protein with multiple cysteine rich domains, a transmembrane domain, a tyrosine kinase domain, a phosphotidylinositol-3 kinase binding site and a PDZ domain binding motif. The protein binds to and is activated by neuregulins and other factors and induces a variety of cellular responses including mitogenesis and differentiation. Multiple proteolytic events allow for the release of a cytoplasmic fragment and an extracellular fragment. Mutations in this gene have been associated with cancer. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
Other Designations
avian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4|receptor tyrosine-protein kinase erbB-4|tyrosine kinase-type cell surface receptor HER4|v-erb-a avian erythroblastic leukemia viral oncogene homolog-like 4|v-erb-a erythroblastic leukemia v
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Resistance to receptor-blocking therapies primes tumors as targets for HER3-homing nanobiologics.
Sims JD, Taguiam JM, Alonso-Valenteen F, Markman J, Agadjanian H, Chu D, Lubow J, Abrol R, Srinivas D, Jain A, Han B, Qu Y, Mirzadehgan P, Hwang JY, Rentsendorj A, Chung A, Lester J, Karlan BY, Gray HB, Gross Z, Giuliano A, Cui X, Medina-Kauwe LK.
Journal of Controlled Release : Official Journal of the Controlled Release Society 2017 Dec; 271:127.
Application:PI, Recombinant protein.
-
Targeting Trastuzumab-Resistant HER2+ Breast Cancer with a HER3-Targeting Nanoparticle.
Lali K. MEDINA-KAUWE, Jessica SIMS, Michael TAGUAIM, Chris HANSON, Xiaojiang CUI
United States Patent Application Publication 2016 Mar; [Epub].
Application:ELISA, Human, Serum.
-
Resistance to receptor-blocking therapies primes tumors as targets for HER3-homing nanobiologics.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com