ERBB3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ERBB3 expression in transfected 293T cell line (H00002065-T01) by ERBB3 MaxPab polyclonal antibody.
Lane 1: ERBB3 transfected lysate(36.50 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between ERBB3 and ERBB2. HeLa cells were stained with anti-ERBB3 rabbit purified polyclonal 1:1200 and anti-ERBB2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ERBB3 protein.
Immunogen
ERBB3 (AAH02706.1, 1 a.a. ~ 331 a.a) full-length human protein.
Sequence
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKAF
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ERBB3 expression in transfected 293T cell line (H00002065-T01) by ERBB3 MaxPab polyclonal antibody.
Lane 1: ERBB3 transfected lysate(36.50 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between ERBB3 and ERBB2. HeLa cells were stained with anti-ERBB3 rabbit purified polyclonal 1:1200 and anti-ERBB2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — ERBB3
Entrez GeneID
2065GeneBank Accession#
BC002706.2Protein Accession#
AAH02706.1Gene Name
ERBB3
Gene Alias
ErbB-3, HER3, LCCS2, MDA-BF-1, MGC88033, c-erbB-3, c-erbB3, erbB3-S, p180-ErbB3, p45-sErbB3, p85-sErbB3
Gene Description
v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq
Other Designations
erbB-3|lethal congenital contracture syndrome 2|v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com