EPS8 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
EPS8 MaxPab polyclonal antibody. Western Blot analysis of EPS8 expression in human liver.
Western Blot (Cell lysate)
EPS8 MaxPab polyclonal antibody. Western Blot analysis of EPS8 expression in K-562.
Western Blot (Transfected lysate)
Western Blot analysis of EPS8 expression in transfected 293T cell line (H00002059-T01) by EPS8 MaxPab polyclonal antibody.
Lane 1: EPS8 transfected lysate(90.42 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human EPS8 protein.
Immunogen
EPS8 (NP_004438.3, 1 a.a. ~ 822 a.a) full-length human protein.
Sequence
MNGHISNHPSSFGMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALRMISNADPSIPPPPRAPAPAPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRKKNKKGKRKGPGEGVLTLRAKPPPPDEFLDCFQKFKHGFNLLAKLKSHIQNPSAADLVHFLFTPLNMVVQATGGPELASSVLSPLLNKDTIDFLNYTVNGDERQLWMSLGGTWMKARAEWPKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADGYAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKTQPKKYAKSKYDFVARNNSELSVLKDDILEILDDRKQWWKVRNASGDSGFVPNNILDIVRPPESGLGRADPPYTHTIQKQRMEYGPRPADTPPAPSPPPTPAPVPVPLPPSTPAPVPVSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIHRLTIGRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGARVYSQITVQKAALEDSSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
EPS8 MaxPab polyclonal antibody. Western Blot analysis of EPS8 expression in human liver.Western Blot (Cell lysate)
EPS8 MaxPab polyclonal antibody. Western Blot analysis of EPS8 expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of EPS8 expression in transfected 293T cell line (H00002059-T01) by EPS8 MaxPab polyclonal antibody.
Lane 1: EPS8 transfected lysate(90.42 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — EPS8
Entrez GeneID
2059GeneBank Accession#
NM_004447Protein Accession#
NP_004438.3Gene Name
EPS8
Gene Alias
-
Gene Description
epidermal growth factor receptor pathway substrate 8
Omim ID
600206Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the EPS8 family. This protein contains one PH domain and one SH3 domain. It functions as part of the EGFR pathway, though its exact role has not been determined. Highly similar proteins in other organisms are involved in the transduction of signals from Ras to Rac and growth factor-mediated actin remodeling. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com