Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EPHX2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002053-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EPHX2 partial ORF ( NP_001970, 456 a.a. - 555 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002053-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2053
  • Gene Name:
  • EPHX2
  • Gene Alias:
  • CEH,SEH
  • Gene Description:
  • epoxide hydrolase 2, cytoplasmic
  • Gene Summary:
  • This gene encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq
  • Other Designations:
  • epoxide hydratase,epoxide hydrolase 2, cytosolic,epoxide hydrolase, soluble
  • RSS
  • YouTube
  • Linkedin
  • Facebook