EPHB3 monoclonal antibody (M10), clone 3F12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant EPHB3.
Immunogen
EPHB3 (NP_004434, 899 a.a. ~ 997 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQ
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EPHB3 monoclonal antibody (M10), clone 3F12 Western Blot analysis of EPHB3 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of EPHB3 expression in transfected 293T cell line by EPHB3 monoclonal antibody (M10), clone 3F12.
Lane 1: EPHB3 transfected lysate (Predicted MW: 110.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of EPHB3 transfected lysate using anti-EPHB3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with EPHB3 monoclonal antibody.ELISA
-
Gene Info — EPHB3
Entrez GeneID
2049GeneBank Accession#
NM_004443Protein Accession#
NP_004434Gene Name
EPHB3
Gene Alias
ETK2, HEK2, TYRO6
Gene Description
EPH receptor B3
Omim ID
601839Gene Ontology
HyperlinkGene Summary
Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. [provided by RefSeq
Other Designations
EPH-like tyrosine kinase-2|ephrin receptor EphB3|human embryo kinase 2
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
YES oncogenic activity is specified by its SH4 domain and regulates RAS/MAPK signaling in colon carcinoma cells.
Dubois F, Leroy C, Simon V, Benistant C, Roche S.
American Journal of Cancer Research 2015 May; 5(6):1972.
Application:IP, Human, HT29 cells.
-
YES oncogenic activity is specified by its SH4 domain and regulates RAS/MAPK signaling in colon carcinoma cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com