EPHB2 monoclonal antibody (M03), clone 4D1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EPHB2.
Immunogen
EPHB2 (NP_059145, 226 a.a. ~ 325 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIP
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EPHB2 monoclonal antibody (M03), clone 4D1 Western Blot analysis of EPHB2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EPHB2 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — EPHB2
Entrez GeneID
2048GeneBank Accession#
NM_017449Protein Accession#
NP_059145Gene Name
EPHB2
Gene Alias
CAPB, DRT, EPHT3, ERK, Hek5, MGC87492, PCBC, Tyro5
Gene Description
EPH receptor B2
Gene Ontology
HyperlinkGene Summary
Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. [provided by RefSeq
Other Designations
OTTHUMP00000002914|OTTHUMP00000002916|developmentally-regulated eph-related tyrosine kinase|elk-related tyrosine kinase|eph tyrosine kinase 3|ephrin receptor EphB2|prostate cancer-brain cancer susceptibility
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com