Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EPHB2 polyclonal antibody (A01)

  • Catalog # : H00002048-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant EPHB2.
  • Immunogen:
  • EPHB2 (NP_059145, 226 a.a. ~ 325 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • CIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002048-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2048
  • Gene Name:
  • EPHB2
  • Gene Alias:
  • CAPB,DRT,EPHT3,ERK,Hek5,MGC87492,PCBC,Tyro5
  • Gene Description:
  • EPH receptor B2
  • Gene Summary:
  • Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000002914,OTTHUMP00000002916,developmentally-regulated eph-related tyrosine kinase,elk-related tyrosine kinase,eph tyrosine kinase 3,ephrin receptor EphB2,prostate cancer-brain cancer susceptibility
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook