EPHA3 monoclonal antibody (M01), clone 3A12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EPHA3.
Immunogen
EPHA3 (AAH63282, 202 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (39.38 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
EPHA3 monoclonal antibody (M01), clone 3A12. Western Blot analysis of EPHA3 expression in human spleen.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EPHA3 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of EPHA3 over-expressed 293 cell line, cotransfected with EPHA3 Validated Chimera RNAi ( Cat # H00002042-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with EPHA3 monoclonal antibody (M01) clone 3A12 (Cat # H00002042-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — EPHA3
Entrez GeneID
2042GeneBank Accession#
BC063282Protein Accession#
AAH63282Gene Name
EPHA3
Gene Alias
ETK, ETK1, HEK, HEK4, TYRO4
Gene Description
EPH receptor A3
Omim ID
179611Gene Ontology
HyperlinkGene Summary
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Two alternatively spliced transcript variants have been described for this gene. [provided by RefSeq
Other Designations
TYRO4 protein tyrosine kinase|eph-like tyrosine kinase 1|ephrin receptor EphA3|human embryo kinase 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
EPHA3 regulates the multidrug resistance of small cell lung cancer via the PI3K/BMX/STAT3 sign.
Peng J, Wang Q, Liu H, Ye M, Wu X, Guo L.
Tumour Biology 2016 Sep; 37(9):11959.
Application:WB-Tr, Human, H69, H69AR, H446, H146, H1688 cells.
-
EPHA3 regulates the multidrug resistance of small cell lung cancer via the PI3K/BMX/STAT3 sign.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com