Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EPB41L1 polyclonal antibody (A01)

  • Catalog # : H00002036-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant EPB41L1.
  • Immunogen:
  • EPB41L1 (NP_818932, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002036-A01
    Western Blot detection against Immunogen (35.79 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2036
  • Gene Name:
  • EPB41L1
  • Gene Alias:
  • 4.1N,DKFZp686H17242,KIAA0338,MGC11072
  • Gene Description:
  • erythrocyte membrane protein band 4.1-like 1
  • Gene Summary:
  • Erythrocyte membrane protein band 4.1 (EPB41) is a multifunctional protein that mediates interactions between the erythrocyte cytoskeleton and the overlying plasma membrane. The protein encoded by this gene is a neuronally-enriched protein that is structurally similar to EPB41. The encoded protein binds and stabilizes D2 and D3 dopamine receptors at the neuronal plasma membrane. Multiple transcript variants encoding different isoforms have been found for this gene, but the full-length nature of only two of them has been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030825,OTTHUMP00000030829,neuron-type nonerythroid protein 4.1,neuronal protein 4.1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook