EPB41 monoclonal antibody (M01), clone 3D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EPB41.
Immunogen
EPB41 (AAH39079, 116 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECSKIEVKEESPQSKAETELKASQKPIRKHRNMHCKVSLLDDTVYECV
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of EPB41 expression in transfected 293T cell line by EPB41 monoclonal antibody (M01), clone 3D9.
Lane 1: EPB41 transfected lysate(81 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EPB41 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EPB41 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to EPB41 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — EPB41
Entrez GeneID
2035GeneBank Accession#
BC039079Protein Accession#
AAH39079Gene Name
EPB41
Gene Alias
4.1R, EL1, HE
Gene Description
erythrocyte membrane protein band 4.1 (elliptocytosis 1, RH-linked)
Omim ID
130500Gene Ontology
HyperlinkGene Summary
Elliptocytosis is a hematologic disorder characterized by elliptically shaped erythrocytes and a variable degree of hemolytic anemia. Inherited as an autosomal dominant, elliptocytosis results from mutation in any one of several genes encoding proteins of the red cell membrane skeleton. The form discussed here is the one found in the 1950s to be linked to Rh blood group and more recently shown to be caused by a defect in protein 4.1. 'Rh-unlinked' forms of elliptocytosis are caused by mutation in the alpha-spectrin gene (MIM 182860), the beta-spectrin gene (MIM 182870), or the band 3 gene (MIM 109270).[supplied by OMIM
Other Designations
OTTHUMP00000003772|OTTHUMP00000003773|OTTHUMP00000003774|erythrocyte surface protein band 4.1
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com