EMP3 monoclonal antibody (M01), clone 3D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
EMP3 monoclonal antibody (M01), clone 3D4 Western Blot analysis of EMP3 expression in C32 ( Cat # L002V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of EMP3 expression in transfected 293T cell line by EMP3 monoclonal antibody (M01), clone 3D4.
Lane 1: EMP3 transfected lysate(18.429 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EMP3 on formalin-fixed paraffin-embedded human lymphoma tissue. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (43.67 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant EMP3.
Immunogen
EMP3 (AAH09718, 1 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.67 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EMP3 monoclonal antibody (M01), clone 3D4 Western Blot analysis of EMP3 expression in C32 ( Cat # L002V1 ).Western Blot (Transfected lysate)
Western Blot analysis of EMP3 expression in transfected 293T cell line by EMP3 monoclonal antibody (M01), clone 3D4.
Lane 1: EMP3 transfected lysate(18.429 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EMP3 on formalin-fixed paraffin-embedded human lymphoma tissue. [antibody concentration 3 ug/ml]ELISA
-
Gene Info — EMP3
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com